SCOPe 2.07: Domain d3nouc2: 3nou C:118-309

Lineage for d3nouc2 (3nou C:118-309)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.1: GAF domain [55782] (8 proteins)

6. Protein Bacteriophytochrome BphP [160661] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [160662] (5 PDB entries)
   Uniprot Q9HWR3 118-309

8. Domain d3nouc2: 3nou C:118-309 [247990]
   Other proteins in same PDB: d3nouc1, d3nouc3
   automated match to d3nhqa2
   complexed with bla

Details for d3nouc2

PDB Entry: 3nou, 3 Å

PDB Description: light-induced intermediate structure l3 of p. aeruginosa bacteriophytochrome

PDB Compounds: (C:) Bacteriophytochrome

SCOPe Domain Sequences for d3nouc2:

Sequence; same for both SEQRES and ATOM records:

>d3nouc2 d.110.2.1 (C:118-309) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
lsitsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaes
rredlesylgqrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsy
svlrsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsq
vcsaiverleqg

Timeline for d3nouc2:

• d3nouc2 first appeared in SCOPe 2.04
  
• d3nouc2 appears in SCOPe 2.06
  
• d3nouc2 appears in the current release, SCOPe 2.08