SCOPe 2.07: Domain d3nouc1: 3nou C:4-117

Lineage for d3nouc1 (3nou C:4-117)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
   Pfam PF08446; PAS_2

6. Protein Bacteriophytochrome BphP [160672] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [160674] (7 PDB entries)
   Uniprot Q9HWR3 5-117

8. Domain d3nouc1: 3nou C:4-117 [247989]
   Other proteins in same PDB: d3nouc2, d3nouc3
   automated match to d3nhqa1
   complexed with bla

Details for d3nouc1

PDB Entry: 3nou, 3 Å

PDB Description: light-induced intermediate structure l3 of p. aeruginosa bacteriophytochrome

PDB Compounds: (C:) Bacteriophytochrome

SCOPe Domain Sequences for d3nouc1:

Sequence; same for both SEQRES and ATOM records:

>d3nouc1 d.110.3.9 (C:4-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
itpvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeq
vgpevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadt

Timeline for d3nouc1:

• d3nouc1 first appeared in SCOPe 2.04
  
• d3nouc1 appears in SCOPe 2.06
  
• d3nouc1 appears in the current release, SCOPe 2.08