SCOPe 2.07: Domain d1b34b_: 1b34 B:

Lineage for d1b34b_ (1b34 B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
   forms homo and heteroheptameric ring structures
   Pfam PF01423

6. Protein D2 core SNRNP protein [50186] (3 species)
   3jb9 chains G and l are D2 subunits from fission yeast; not included because sids are not case sensitive

7. Species Human (Homo sapiens) [TaxId:9606] [50187] (11 PDB entries)

8. Domain d1b34b_: 1b34 B: [24797]
   Other proteins in same PDB: d1b34a_
   protein/RNA complex

Details for d1b34b_

PDB Entry: 1b34, 2.5 Å

PDB Description: crystal structure of the d1d2 sub-complex from the human snrnp core domain

PDB Compounds: (B:) protein (small nuclear ribonucleoprotein sm d2)

SCOPe Domain Sequences for d1b34b_:

Sequence, based on SEQRES records:

>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
tgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevpksgkgkk
kskpvnkdryiskmflrgdsvivvlrnpliagk

Sequence, based on observed residues (ATOM records):

>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
tgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemdryiskmflrgd
svivvlrnpliagk

Timeline for d1b34b_:

• d1b34b_ first appeared (with stable ids) in SCOP 1.55
  
• d1b34b_ appears in SCOPe 2.06
  
• d1b34b_ appears in the current release, SCOPe 2.08