| Class b: All beta proteins [48724] (178 folds) |
| Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
| Protein D1 core SNRNP protein [50184] (4 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50185] (11 PDB entries) |
| Domain d1b34a_: 1b34 A: [24796] Other proteins in same PDB: d1b34b_ protein/RNA complex |
PDB Entry: 1b34 (more details), 2.5 Å
SCOPe Domain Sequences for d1b34a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
gnniryfilpdslpldtllv
Timeline for d1b34a_: