Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries) |
Domain d3nn8a1: 3nn8 A:9-121 [247965] Other proteins in same PDB: d3nn8a2, d3nn8c2, d3nn8d2, d3nn8g2 automated match to d1ktrh_ |
PDB Entry: 3nn8 (more details), 3.1 Å
SCOPe Domain Sequences for d3nn8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nn8a1 b.1.1.1 (A:9-121) automated matches {Mouse (Mus musculus) [TaxId: 10090]} pedvkpgasvkisckasgyslstsgmgvnwvkqspgkglewlahiywdddkrynpslksr atltvdktsstvylelrsltsedssvyycarrggsshyyamdywgqgttvtvs
Timeline for d3nn8a1: