Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (19 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries) |
Domain d3nn8a_: 3nn8 A: [247965] automated match to d1ktrh_ |
PDB Entry: 3nn8 (more details), 3.1 Å
SCOPe Domain Sequences for d3nn8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nn8a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qvqlqqsgpedvkpgasvkisckasgyslstsgmgvnwvkqspgkglewlahiywdddkr ynpslksratltvdktsstvylelrsltsedssvyycarrggsshyyamdywgqgttvtv s
Timeline for d3nn8a_: