Lineage for d3neia_ (3nei A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142835Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2142836Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2143052Family c.90.1.0: automated matches [191315] (1 protein)
    not a true family
  6. 2143053Protein automated matches [190076] (5 species)
    not a true protein
  7. 2143066Species Rhodobacter capsulatus [TaxId:272942] [255976] (2 PDB entries)
  8. 2143069Domain d3neia_: 3nei A: [247899]
    automated match to d1cbfa_
    complexed with gol, so4

Details for d3neia_

PDB Entry: 3nei (more details), 2.5 Å

PDB Description: Crystal structure of Precorrin-4 C11-methyltransferase from Rhodobacter capsulatus (no SAH bound)
PDB Compounds: (A:) Precorrin-4 C(11)-methyltransferase

SCOPe Domain Sequences for d3neia_:

Sequence, based on SEQRES records: (download)

>d3neia_ c.90.1.0 (A:) automated matches {Rhodobacter capsulatus [TaxId: 272942]}
mtvhfigagpgaadlitirgrdliascpvclyagslvpeallahcppgakivntapmsld
aiidtiaeahaagqdvarlhsgdlsiwsamgeqlrrlralnipydvtpgvpsfaaaaatl
gaeltlpgvaqsviltrtsgrasampagetlenfartgavlaihlsvhvldevvqklvph
ygedcpvaivwraswpdqrvvratlatlqtslgaelertalilvgrslat

Sequence, based on observed residues (ATOM records): (download)

>d3neia_ c.90.1.0 (A:) automated matches {Rhodobacter capsulatus [TaxId: 272942]}
mtvhfigagpgaadlitirgrdliascpvclyagslvpeallahcppgakivntapmsld
aiidtiaeahaagqdvarlhsgdlsiwsamgeqlrrlralnipydvtpgvpsfaaaaatl
gaeltlpgvaqsviltrtampagetlenfartgavlaihlsvhvldevvqklvphygedc
pvaivwraswpdqrvvratlatlqtslgaelertalilvgrslat

SCOPe Domain Coordinates for d3neia_:

Click to download the PDB-style file with coordinates for d3neia_.
(The format of our PDB-style files is described here.)

Timeline for d3neia_: