Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) |
Family c.90.1.0: automated matches [191315] (1 protein) not a true family |
Protein automated matches [190076] (5 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:272942] [255976] (2 PDB entries) |
Domain d3neib_: 3nei B: [247900] automated match to d1cbfa_ complexed with gol, so4 |
PDB Entry: 3nei (more details), 2.5 Å
SCOPe Domain Sequences for d3neib_:
Sequence, based on SEQRES records: (download)
>d3neib_ c.90.1.0 (B:) automated matches {Rhodobacter capsulatus [TaxId: 272942]} mtvhfigagpgaadlitirgrdliascpvclyagslvpeallahcppgakivntapmsld aiidtiaeahaagqdvarlhsgdlsiwsamgeqlrrlralnipydvtpgvpsfaaaaatl gaeltlpgvaqsviltrtsgrasampagetlenfartgavlaihlsvhvldevvqklvph ygedcpvaivwraswpdqrvvratlatlqtslgaelertalilvgrslat
>d3neib_ c.90.1.0 (B:) automated matches {Rhodobacter capsulatus [TaxId: 272942]} mtvhfigagpgaadlitirgrdliascpvclyagslvpeallahcppgakivntapmsld aiidtiaeahaagqdvarlhsgdlsiwsamgeqlrrlralnipydvtpgvpsfaaaaatl gaeltlpgvaqsviltrtmpagetlenfartgavlaihlsvhvldevvqklvphygedcp vaivwraswpdqrvvratlatlqtslgaelertalilvgrslat
Timeline for d3neib_: