Lineage for d2pdza_ (2pdz A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165991Fold b.36: PDZ domain-like [50155] (1 superfamily)
  4. 165992Superfamily b.36.1: PDZ domain-like [50156] (4 families) (S)
  5. 165993Family b.36.1.1: PDZ domain [50157] (9 proteins)
  6. 166029Protein Syntrophin [50164] (1 species)
  7. 166030Species Mouse (Mus musculus) [TaxId:10090] [50165] (2 PDB entries)
  8. 166032Domain d2pdza_: 2pdz A: [24778]

Details for d2pdza_

PDB Entry: 2pdz (more details)

PDB Description: solution structure of the syntrophin pdz domain in complex with the peptide gvkeslv, nmr, 15 structures

SCOP Domain Sequences for d2pdza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pdza_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus)}
rrrvtvrkadagglgisikggrenkmpiliskifkglaadqtealfvgdailsvngedls
sathdeavqalkktgkevvlevkymk

SCOP Domain Coordinates for d2pdza_:

Click to download the PDB-style file with coordinates for d2pdza_.
(The format of our PDB-style files is described here.)

Timeline for d2pdza_: