SCOPe 2.08: Domain d2pdza_: 2pdz A:

Lineage for d2pdza_ (2pdz A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Syntrophin [50164] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50165] (2 PDB entries)

8. Domain d2pdza_: 2pdz A: [24778]

Details for d2pdza_

PDB Entry: 2pdz

PDB Description: solution structure of the syntrophin pdz domain in complex with the peptide gvkeslv, nmr, 15 structures

PDB Compounds: (A:) syntrophin

SCOPe Domain Sequences for d2pdza_:

Sequence; same for both SEQRES and ATOM records:

>d2pdza_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]}
rrrvtvrkadagglgisikggrenkmpiliskifkglaadqtealfvgdailsvngedls
sathdeavqalkktgkevvlevkymk

Timeline for d2pdza_:

• d2pdza_ first appeared (with stable ids) in SCOP 1.55
  
• d2pdza_ appears in SCOPe 2.07