| Class b: All beta proteins [48724] (176 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.0: automated matches [254217] (1 protein) not a true family |
| Protein automated matches [254496] (10 species) not a true protein |
| Species Yersinia pestis [TaxId:214092] [255971] (1 PDB entry) |
| Domain d3mjfa3: 3mjf A:328-428 [247726] Other proteins in same PDB: d3mjfa1, d3mjfa2 automated match to d1gsoa1 complexed with bme, edo, gol, na, peg, pge, so4 |
PDB Entry: 3mjf (more details), 1.47 Å
SCOPe Domain Sequences for d3mjfa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mjfa3 b.84.2.0 (A:328-428) automated matches {Yersinia pestis [TaxId: 214092]}
erpslgvvlaaggypadyrqgdvihglpqqevkdgkvfhagtklngnhevvtnggrvlcv
talgetvaqaqqyayqlaegiqwegvfcrkdigyraiargk
Timeline for d3mjfa3: