SCOPe 2.04: Domain d3mjfa2: 3mjf A:104-327

Lineage for d3mjfa2 (3mjf A:104-327)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)

6. Protein automated matches [254674] (2 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [255970] (1 PDB entry)

8. Domain d3mjfa2: 3mjf A:104-327 [247725]
   Other proteins in same PDB: d3mjfa1, d3mjfa3
   automated match to d1gsoa3
   complexed with bme, edo, gol, na, peg, pge, so4

Details for d3mjfa2

PDB Entry: 3mjf, 1.47 Å

PDB Description: phosphoribosylamine-glycine ligase from yersinia pestis

PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d3mjfa2:

Sequence; same for both SEQRES and ATOM records:

>d3mjfa2 d.142.1.2 (A:104-327) automated matches {Yersinia pestis [TaxId: 214092]}
skaftkdflarhnipsaeyqnftdveaalayvrqkgapivikadglaagkgvivamtqee
aetavndmlagnafgdaghrivveefldgeeasfivmvdgenvlpmatsqdhkrvgdgdt
gpntggmgayspapvvtddvhqrvmdqviwptvrgmaaegniytgflyaglmisadgqpk
viefncrfgdpetqpimlrmrsdlvelclagtqgklnektsdwd

Timeline for d3mjfa2:

• d3mjfa2 is new in SCOPe 2.04-stable
  
• d3mjfa2 appears in SCOPe 2.05
  
• d3mjfa2 appears in the current release, SCOPe 2.08