Lineage for d3mgha3 (3mgh A:386-575)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612756Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2612757Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2612791Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2612969Protein DNA polymerase lambda [102943] (1 species)
  7. 2612970Species Human (Homo sapiens) [TaxId:9606] [102944] (27 PDB entries)
  8. 2613015Domain d3mgha3: 3mgh A:386-575 [247696]
    Other proteins in same PDB: d3mgha1, d3mgha2, d3mghc1, d3mghc2
    automated match to d1rzta3
    protein/DNA complex; complexed with na; mutant

Details for d3mgha3

PDB Entry: 3mgh (more details), 2.4 Å

PDB Description: binary complex of a dna polymerase lambda loop mutant
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3mgha3:

Sequence, based on SEQRES records: (download)

>d3mgha3 d.218.1.2 (A:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs
rlldslrqegfltddlvkgetkylgvcrlpgpgrrhrrldiivvpysefacallyftgsa
hfnrsmralaktkgmslsehalstavvrnthgckvgpgrvlptptekdvfrllglpyrep
aerdw

Sequence, based on observed residues (ATOM records): (download)

>d3mgha3 d.218.1.2 (A:386-575) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
rmpreeateieqtvqkaaqafnsgllcvacgsyrrgkatcgdvdvlithpdgrshrgifs
rlldslrqegfltddlvkgetkylgvcrlpgpgrrhrrldiivvpysefacallyftgsa
hfnrsmralaktkgmslsehalstavvrnckvgpgrvlptptekdvfrllglpyrepaer
dw

SCOPe Domain Coordinates for d3mgha3:

Click to download the PDB-style file with coordinates for d3mgha3.
(The format of our PDB-style files is described here.)

Timeline for d3mgha3: