SCOPe 2.07: Domain d3mgha1: 3mgh A:249-328

Lineage for d3mgha1 (3mgh A:249-328)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase lambda [101251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101252] (28 PDB entries)

8. Domain d3mgha1: 3mgh A:249-328 [247694]
   Other proteins in same PDB: d3mgha2, d3mgha3, d3mghc2, d3mghc3
   automated match to d1rzta1
   protein/DNA complex; complexed with na; mutant

Details for d3mgha1

PDB Entry: 3mgh, 2.4 Å

PDB Description: binary complex of a dna polymerase lambda loop mutant

PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d3mgha1:

Sequence; same for both SEQRES and ATOM records:

>d3mgha1 a.60.6.1 (A:249-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
atnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkr
maekiieilesghlrkldhi

Timeline for d3mgha1:

• d3mgha1 first appeared in SCOPe 2.04
  
• d3mgha1 appears in SCOPe 2.06
  
• d3mgha1 appears in the current release, SCOPe 2.08