Lineage for d3mg4z_ (3mg4 Z:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2225349Domain d3mg4z_: 3mg4 Z: [247692]
    Other proteins in same PDB: d3mg4g_, d3mg4u_
    automated match to d4j70l_
    complexed with lxt, mes, mg

Details for d3mg4z_

PDB Entry: 3mg4 (more details), 3.11 Å

PDB Description: structure of yeast 20s proteasome with compound 1
PDB Compounds: (Z:) Proteasome component C5

SCOPe Domain Sequences for d3mg4z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mg4z_ d.153.1.4 (Z:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

SCOPe Domain Coordinates for d3mg4z_:

Click to download the PDB-style file with coordinates for d3mg4z_.
(The format of our PDB-style files is described here.)

Timeline for d3mg4z_: