Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.2: RBP11/RpoL [64311] (3 proteins) |
Protein automated matches [190337] (2 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187160] (5 PDB entries) |
Domain d3m3yk_: 3m3y K: [247597] Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye1, d3m3ye2, d3m3yf_, d3m3yh_, d3m3yi1, d3m3yi2, d3m3yj_, d3m3yl_ automated match to d1twfk_ protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn |
PDB Entry: 3m3y (more details), 3.18 Å
SCOPe Domain Sequences for d3m3yk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m3yk_ d.74.3.2 (K:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
Timeline for d3m3yk_: