![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
![]() | Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
![]() | Family a.143.1.2: RPB6 [55294] (2 proteins) |
![]() | Protein automated matches [254699] (3 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255949] (3 PDB entries) |
![]() | Domain d3m3yf_: 3m3y F: [247592] Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye1, d3m3ye2, d3m3yh_, d3m3yi1, d3m3yi2, d3m3yj_, d3m3yk_, d3m3yl_ automated match to d1twff_ protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn |
PDB Entry: 3m3y (more details), 3.18 Å
SCOPe Domain Sequences for d3m3yf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m3yf_ a.143.1.2 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip lvirrylpdgsfedwsveelivdl
Timeline for d3m3yf_: