Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily) core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) automatically mapped to Pfam PF01191 |
Family d.78.1.0: automated matches [254302] (1 protein) not a true family |
Protein automated matches [254702] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255952] (3 PDB entries) |
Domain d3m3ye2: 3m3y E:144-215 [247591] Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye1, d3m3yf_, d3m3yh_, d3m3yi1, d3m3yi2, d3m3yj_, d3m3yk_, d3m3yl_ automated match to d1dzfa2 protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn |
PDB Entry: 3m3y (more details), 3.18 Å
SCOPe Domain Sequences for d3m3ye2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m3ye2 d.78.1.0 (E:144-215) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse tsgryasyricm
Timeline for d3m3ye2: