Lineage for d3m3ye2 (3m3y E:144-215)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565294Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
    core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta
  4. 2565295Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) (S)
    automatically mapped to Pfam PF01191
  5. 2565335Family d.78.1.0: automated matches [254302] (1 protein)
    not a true family
  6. 2565336Protein automated matches [254702] (3 species)
    not a true protein
  7. 2565337Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255952] (3 PDB entries)
  8. 2565338Domain d3m3ye2: 3m3y E:144-215 [247591]
    Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye1, d3m3yf_, d3m3yh_, d3m3yi1, d3m3yi2, d3m3yj_, d3m3yk_, d3m3yl_
    automated match to d1dzfa2
    protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn

Details for d3m3ye2

PDB Entry: 3m3y (more details), 3.18 Å

PDB Description: RNA polymerase II elongation complex C
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3m3ye2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m3ye2 d.78.1.0 (E:144-215) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

SCOPe Domain Coordinates for d3m3ye2:

Click to download the PDB-style file with coordinates for d3m3ye2.
(The format of our PDB-style files is described here.)

Timeline for d3m3ye2: