SCOPe 2.07: Domain d3m3ye2: 3m3y E:144-215

Lineage for d3m3ye2 (3m3y E:144-215)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily)
   core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families)
   automatically mapped to Pfam PF01191

5. Family d.78.1.0: automated matches [254302] (1 protein)
   not a true family

6. Protein automated matches [254702] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255952] (3 PDB entries)

8. Domain d3m3ye2: 3m3y E:144-215 [247591]
   Other proteins in same PDB: d3m3ya_, d3m3yb_, d3m3ye1, d3m3yf_, d3m3yh_, d3m3yi1, d3m3yi2, d3m3yj_, d3m3yk_, d3m3yl_
   automated match to d1dzfa2
   protein/DNA complex; protein/RNA complex; complexed with c7p, mg, zn

Details for d3m3ye2

PDB Entry: 3m3y, 3.18 Å

PDB Description: RNA polymerase II elongation complex C

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III subunit RPABC1

SCOPe Domain Sequences for d3m3ye2:

Sequence; same for both SEQRES and ATOM records:

>d3m3ye2 d.78.1.0 (E:144-215) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse
tsgryasyricm

Timeline for d3m3ye2:

• d3m3ye2 first appeared in SCOPe 2.04
  
• d3m3ye2 appears in SCOPe 2.06
  
• d3m3ye2 appears in the current release, SCOPe 2.08