Lineage for d3lvpc_ (3lvp C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219839Protein Insulin-like growth factor 1 receptor [69825] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2219840Species Human (Homo sapiens) [TaxId:9606] [69826] (18 PDB entries)
  8. 2219891Domain d3lvpc_: 3lvp C: [247525]
    automated match to d1p4ob_
    complexed with epe, pdr, so4

Details for d3lvpc_

PDB Entry: 3lvp (more details), 3 Å

PDB Description: Crystal structure of bisphosphorylated IGF1-R Kinase domain (2P) in complex with a bis-azaindole inhibitor
PDB Compounds: (C:) insulin-like growth factor 1 receptor

SCOPe Domain Sequences for d3lvpc_:

Sequence, based on SEQRES records: (download)

>d3lvpc_ d.144.1.7 (C:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
yvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrerie
flneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpvlap
pslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyy
rkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvm
egglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk

Sequence, based on observed residues (ATOM records): (download)

>d3lvpc_ d.144.1.7 (C:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
yvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmrerie
flneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpevlappslsk
miqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyetdyyrkkgl
lpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldk
pdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk

SCOPe Domain Coordinates for d3lvpc_:

Click to download the PDB-style file with coordinates for d3lvpc_.
(The format of our PDB-style files is described here.)

Timeline for d3lvpc_: