SCOPe 2.01: Domain d1kevc1: 1kev C:1-139,C:314-351

Lineage for d1kevc1 (1kev C:1-139,C:314-351)

Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds)
Fold b.35: GroES-like [50128] (2 superfamilies)
contains barrel, partly opened; n*=4, S*=8; meander
Superfamily b.35.1: GroES-like [50129] (3 families)
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
C-terminal domain is alpha/beta (classical Rossmann-fold)
Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
Species Clostridium beijerinckii [TaxId:1520] [50143] (3 PDB entries)
Domain d1kevc1: 1kev C:1-139,C:314-351 [24751]
Other proteins in same PDB: d1keva2, d1kevb2, d1kevc2, d1kevd2
complexed with ndp, zn

Details for d1kevc1

PDB Entry: 1kev (more details), 2.05 Å

PDB Description: structure of nadp-dependent alcohol dehydrogenase

PDB Compounds: (C:) NADP-dependent alcohol dehydrogenase

SCOPe Domain Sequences for d1kevc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kevc1 b.35.1.2 (C:1-139,C:314-351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdXvdlsklvthvyhgfdhieealllmkdkpkdlikavvil

SCOPe Domain Coordinates for d1kevc1:

Click to download the PDB-style file with coordinates for d1kevc1.
(The format of our PDB-style files is described here.)

Timeline for d1kevc1: