SCOP 1.55: Domain d1kevc1: 1kev C:1-150,C:315-351

Lineage for d1kevc1 (1kev C:1-150,C:315-351)

Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds)
Fold b.35: GroES-like [50128] (2 superfamilies)
Superfamily b.35.1: GroES-like [50129] (2 families)
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (5 proteins)
Protein Bacterial secondary alcohol dehydrogenase [50142] (2 species)
Species Clostridium beijerinckii [50143] (2 PDB entries)
Domain d1kevc1: 1kev C:1-150,C:315-351 [24751]
Other proteins in same PDB: d1keva2, d1kevb2, d1kevc2, d1kevd2

Details for d1kevc1

PDB Entry: 1kev (more details), 2.05 Å

PDB Description: structure of nadp-dependent alcohol dehydrogenase

SCOP Domain Sequences for d1kevc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kevc1 b.35.1.2 (C:1-150,C:315-351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii}
mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfqqhsngmlagwkfsnfkdgvf
geyfhvndadmnlailpkdmplenavmitdXdlsklvthvyhgfdhieealllmkdkpkd
likavvil

SCOP Domain Coordinates for d1kevc1:

Click to download the PDB-style file with coordinates for d1kevc1.
(The format of our PDB-style files is described here.)

Timeline for d1kevc1: