Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
Protein automated matches [227126] (21 species) not a true protein |
Species Escherichia coli [TaxId:83334] [255938] (3 PDB entries) |
Domain d3lq2a2: 3lq2 A:471-700 [247497] Other proteins in same PDB: d3lq2a1, d3lq2a3, d3lq2b1, d3lq2b3 automated match to d2ieaa1 complexed with epe, mg, po4, tdp; mutant |
PDB Entry: 3lq2 (more details), 1.96 Å
SCOPe Domain Sequences for d3lq2a2:
Sequence, based on SEQRES records: (download)
>d3lq2a2 c.36.1.0 (A:471-700) automated matches {Escherichia coli [TaxId: 83334]} eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg lfrqigiyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnl pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa
>d3lq2a2 c.36.1.0 (A:471-700) automated matches {Escherichia coli [TaxId: 83334]} eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg lfrqigiyspedekgqilqeginelgagcswlaaatsystnnlpmipfyiyysmfgfqri gdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydpayayeva vimhdglermygekqenvyyyittlnenyhmpa
Timeline for d3lq2a2: