Lineage for d3lq2b2 (3lq2 B:471-700)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472772Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2472773Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2473412Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2473413Protein automated matches [227126] (21 species)
    not a true protein
  7. 2473496Species Escherichia coli [TaxId:83334] [255938] (3 PDB entries)
  8. 2473498Domain d3lq2b2: 3lq2 B:471-700 [247500]
    Other proteins in same PDB: d3lq2a1, d3lq2a3, d3lq2b1, d3lq2b3
    automated match to d2ieaa1
    complexed with epe, mg, po4, tdp; mutant

Details for d3lq2b2

PDB Entry: 3lq2 (more details), 1.96 Å

PDB Description: e. coli pyruvate dehydrogenase complex e1 e235a mutant with low tdp concentration
PDB Compounds: (B:) Pyruvate dehydrogenase E1 component

SCOPe Domain Sequences for d3lq2b2:

Sequence, based on SEQRES records: (download)

>d3lq2b2 c.36.1.0 (B:471-700) automated matches {Escherichia coli [TaxId: 83334]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnl
pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl
tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa

Sequence, based on observed residues (ATOM records): (download)

>d3lq2b2 c.36.1.0 (B:471-700) automated matches {Escherichia coli [TaxId: 83334]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspedekgqilqeginelgagcswlaaatsystnnlpmipfyiyysmfgfqri
gdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsltipncisydpayayeva
vimhdglermygekqenvyyyittlnenyhmpa

SCOPe Domain Coordinates for d3lq2b2:

Click to download the PDB-style file with coordinates for d3lq2b2.
(The format of our PDB-style files is described here.)

Timeline for d3lq2b2: