Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (28 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [255933] (1 PDB entry) |
Domain d3loqb1: 3loq B:1-144 [247482] Other proteins in same PDB: d3loqa3, d3loqb2 automated match to d2dumb_ complexed with act, amp, cl |
PDB Entry: 3loq (more details), 2.32 Å
SCOPe Domain Sequences for d3loqb1:
Sequence, based on SEQRES records: (download)
>d3loqb1 c.26.2.0 (B:1-144) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mllptdlsensfkvleylgdfkkvgveeigvlfvinltklstvsggididhyidemseka eevlpevaqkieaagikaevikpfpagdpvveiikasenysfiamgsrgaskfkkillgs vsegvlhdskvpvyifkhdmvvns
>d3loqb1 c.26.2.0 (B:1-144) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mllptdlsensfkvleylgdfkkvgveeigvlfvinltklsdidhyidemsekaeevlpe vaqkieaagikaevikpfpagdpvveiikasenysfiamgsrgaskfkkillgsvsegvl hdskvpvyifkhdmvvns
Timeline for d3loqb1: