SCOPe 2.06: Domain d3loqb1: 3loq B:1-144

Lineage for d3loqb1 (3loq B:1-144)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (24 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [255933] (1 PDB entry)

8. Domain d3loqb1: 3loq B:1-144 [247482]
   Other proteins in same PDB: d3loqa3, d3loqb2
   automated match to d2dumb_
   complexed with act, amp, cl

Details for d3loqb1

PDB Entry: 3loq, 2.32 Å

PDB Description: The crystal structure of a universal stress protein from Archaeoglobus fulgidus DSM 4304

PDB Compounds: (B:) Universal stress protein

SCOPe Domain Sequences for d3loqb1:

Sequence, based on SEQRES records:

>d3loqb1 c.26.2.0 (B:1-144) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mllptdlsensfkvleylgdfkkvgveeigvlfvinltklstvsggididhyidemseka
eevlpevaqkieaagikaevikpfpagdpvveiikasenysfiamgsrgaskfkkillgs
vsegvlhdskvpvyifkhdmvvns

Sequence, based on observed residues (ATOM records):

>d3loqb1 c.26.2.0 (B:1-144) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mllptdlsensfkvleylgdfkkvgveeigvlfvinltklsdidhyidemsekaeevlpe
vaqkieaagikaevikpfpagdpvveiikasenysfiamgsrgaskfkkillgsvsegvl
hdskvpvyifkhdmvvns

Timeline for d3loqb1:

• d3loqb1 first appeared in SCOPe 2.04
  
• d3loqb1 appears in SCOPe 2.05
  
• d3loqb1 appears in SCOPe 2.07
  
• d3loqb1 appears in the current release, SCOPe 2.08