Lineage for d3lkza_ (3lkz A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501329Family c.66.1.25: mRNA cap methylase [88785] (3 proteins)
  6. 2501374Protein automated matches [190302] (8 species)
    not a true protein
  7. 2501393Species West Nile virus [TaxId:11082] [187969] (2 PDB entries)
  8. 2501394Domain d3lkza_: 3lkz A: [247469]
    automated match to d2px8b_
    complexed with gol, sfg

Details for d3lkza_

PDB Entry: 3lkz (more details), 2 Å

PDB Description: Structural and functional analyses of a conserved hydrophobic pocket of flavivirus methyltransferase
PDB Compounds: (A:) non-structural protein 5

SCOPe Domain Sequences for d3lkza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lkza_ c.66.1.25 (A:) automated matches {West Nile virus [TaxId: 11082]}
grtlgevwkerlnqmtkeeftryrkeaiievdrsaakharkegnvtgghpvsrgtaklrw
lverrflepvgkvidlgcgrggwcyymatqkrvqevrgytkggpgheepqlvqsygwniv
tmksgvdvfyrpseccdtllcdigessssaeveehrtirvlemvedwlhrgprefcvkvl
cpympkviekmellqrryggglvrnplsrnsthemywvsrasgnvvhsvnmtsqvllgrm
ekrtwkgpqyeedvnlgsgtra

SCOPe Domain Coordinates for d3lkza_:

Click to download the PDB-style file with coordinates for d3lkza_.
(The format of our PDB-style files is described here.)

Timeline for d3lkza_: