SCOP 1.67: Domain d1agnd1: 1agn D:1-162,D:339-374

Lineage for d1agnd1 (1agn D:1-162,D:339-374)

Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds)
Fold b.35: GroES-like [50128] (2 superfamilies)
contains barrel, partly opened; n*=4, S*=8; meander
Superfamily b.35.1: GroES-like [50129] (2 families)
Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (11 proteins)
C-terminal domain is alpha/beta (classical Rossmann-fold)
Protein Alcohol dehydrogenase [50137] (9 species)
contains a Zn-finger subdomain, residues 94-117
Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (18 PDB entries)
Domain d1agnd1: 1agn D:1-162,D:339-374 [24740]
Other proteins in same PDB: d1agna2, d1agnb2, d1agnc2, d1agnd2
sigma isozyme
complexed with act, nad, zn

Details for d1agnd1

PDB Description: x-ray structure of human sigma alcohol dehydrogenase

SCOP Domain Sequences for d1agnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agnd1 b.35.1.2 (D:1-162,D:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
vladgttrftckgkpvhhfmntstfteytvvdessvakiddXkfdldqlithvlpfkkis
egfellnsgqsirtvltf

SCOP Domain Coordinates for d1agnd1:

Click to download the PDB-style file with coordinates for d1agnd1.
(The format of our PDB-style files is described here.)

Timeline for d1agnd1: