Lineage for d1agnd1 (1agn D:1-162,D:339-374)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785352Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2785353Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2785485Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2785506Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 2785641Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (24 PDB entries)
    Uniprot P00326 ! Uniprot P00325 ! Uniprot P07327
  8. 2785677Domain d1agnd1: 1agn D:1-162,D:339-374 [24740]
    Other proteins in same PDB: d1agna2, d1agnb2, d1agnc2, d1agnd2
    sigma isozyme
    complexed with act, nad, zn

Details for d1agnd1

PDB Entry: 1agn (more details), 3 Å

PDB Description: x-ray structure of human sigma alcohol dehydrogenase
PDB Compounds: (D:) human sigma alcohol dehydrogenase

SCOPe Domain Sequences for d1agnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agnd1 b.35.1.2 (D:1-162,D:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]}
gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
vladgttrftckgkpvhhfmntstfteytvvdessvakiddXkfdldqlithvlpfkkis
egfellnsgqsirtvltf

SCOPe Domain Coordinates for d1agnd1:

Click to download the PDB-style file with coordinates for d1agnd1.
(The format of our PDB-style files is described here.)

Timeline for d1agnd1: