Lineage for d1agnc1 (1agn C:1-162,C:339-374)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373088Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 373089Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 373153Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (11 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 373171Protein Alcohol dehydrogenase [50137] (9 species)
    contains a Zn-finger subdomain, residues 94-117
  7. 373272Species Human (Homo sapiens), different isozymes [TaxId:9606] [50139] (18 PDB entries)
  8. 373313Domain d1agnc1: 1agn C:1-162,C:339-374 [24739]
    Other proteins in same PDB: d1agna2, d1agnb2, d1agnc2, d1agnd2

Details for d1agnc1

PDB Entry: 1agn (more details), 3 Å

PDB Description: x-ray structure of human sigma alcohol dehydrogenase

SCOP Domain Sequences for d1agnc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agnc1 b.35.1.2 (C:1-162,C:339-374) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes}
gtagkvikckaavlweqkqpfsieeievappktkevrikilatgicrtddhvikgtmvsk
fpvivgheatgivesigegvttvkpgdkviplflpqcrecnacrnpdgnlcirsditgrg
vladgttrftckgkpvhhfmntstfteytvvdessvakiddXkfdldqlithvlpfkkis
egfellnsgqsirtvltf

SCOP Domain Coordinates for d1agnc1:

Click to download the PDB-style file with coordinates for d1agnc1.
(The format of our PDB-style files is described here.)

Timeline for d1agnc1: