Lineage for d3kjrb1 (3kjr B:5-187)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2511486Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2511487Protein automated matches [190777] (27 species)
    not a true protein
  7. 2511574Species Babesia bovis [TaxId:484906] [232542] (3 PDB entries)
  8. 2511576Domain d3kjrb1: 3kjr B:5-187 [247212]
    Other proteins in same PDB: d3kjra2, d3kjrb2
    automated match to d3i3ra1
    complexed with gol, nap, nhe

Details for d3kjrb1

PDB Entry: 3kjr (more details), 1.95 Å

PDB Description: Crystal structure of dihydrofolate reductase/thymidylate synthase from Babesia bovis determined using SlipChip based microfluidics
PDB Compounds: (B:) Dihydrofolate reductase/thymidylate synthase

SCOPe Domain Sequences for d3kjrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kjrb1 c.71.1.0 (B:5-187) automated matches {Babesia bovis [TaxId: 484906]}
yegcgdltifvavalnkvighknqipwphithdfrflrngttyippevlsknpdiqnvvi
fgrktyesipkaslplknrinvilsrtvkevpgclvyedlstairdlranvphnkifilg
gsflykevldnglcdkiyltrlnkeypgdtyfpdipdtfeitaisptfstdfvsydfviy
erk

SCOPe Domain Coordinates for d3kjrb1:

Click to download the PDB-style file with coordinates for d3kjrb1.
(The format of our PDB-style files is described here.)

Timeline for d3kjrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3kjrb2