SCOPe 2.07: Domain d3kjrb2: 3kjr B:205-508

Lineage for d3kjrb2 (3kjr B:205-508)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
   automatically mapped to Pfam PF00303

5. Family d.117.1.0: automated matches [227244] (1 protein)
   not a true family

6. Protein automated matches [227010] (5 species)
   not a true protein

7. Species Babesia bovis [TaxId:484906] [232544] (3 PDB entries)

8. Domain d3kjrb2: 3kjr B:205-508 [247213]
   Other proteins in same PDB: d3kjra1, d3kjrb1
   automated match to d3i3ra2
   complexed with gol, nap, nhe

Details for d3kjrb2

PDB Entry: 3kjr, 1.95 Å

PDB Description: Crystal structure of dihydrofolate reductase/thymidylate synthase from Babesia bovis determined using SlipChip based microfluidics

PDB Compounds: (B:) Dihydrofolate reductase/thymidylate synthase

SCOPe Domain Sequences for d3kjrb2:

Sequence; same for both SEQRES and ATOM records:

>d3kjrb2 d.117.1.0 (B:205-508) automated matches {Babesia bovis [TaxId: 484906]}
gtdisvpkpkyvacpgvrirnheefqyldiladvlshgvlkpnrtgtdayskfgyqmrfd
lsrsfpllttkkvalrsiieellwfikgstngndllaknvriwelngrrdfldkngftdr
eehdlgpiygfqwrhfgaeyldmhadytgkgidqlaeiinriktnpndrrlivcswnvsd
lkkmalppchcffqfyvsdnklscmmhqrscdlglgvpfniasysiltamvaqvcglglg
efvhnladahiyvdhvdavttqiariphpfprlrlnpdirniedftiddivvedyvshpp
ipma

Timeline for d3kjrb2:

• d3kjrb2 first appeared in SCOPe 2.04
  
• d3kjrb2 appears in SCOPe 2.06
  
• d3kjrb2 appears in the current release, SCOPe 2.08