SCOPe 2.07: Domain d3jv4e_: 3jv4 E:

Lineage for d3jv4e_ (3jv4 E:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein automated matches [226855] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224977] (9 PDB entries)

8. Domain d3jv4e_: 3jv4 E: [247057]
   Other proteins in same PDB: d3jv4b_, d3jv4d_, d3jv4f_
   automated match to d1zk9a_

Details for d3jv4e_

PDB Entry: 3jv4, 3.15 Å

PDB Description: Crystal structure of the dimerization domains p50 and RelB

PDB Compounds: (E:) transcription factor relb

SCOPe Domain Sequences for d3jv4e_:

Sequence; same for both SEQRES and ATOM records:

>d3jv4e_ b.1.18.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tselricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsqadvhrqiai
vfktppyedleisepvtvnvflqrltdgvcseplpftylpr

Timeline for d3jv4e_:

• d3jv4e_ first appeared in SCOPe 2.04
  
• d3jv4e_ appears in SCOPe 2.06
  
• d3jv4e_ appears in the current release, SCOPe 2.08