![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins) subgroup of the larger IPT/TIG domain family |
![]() | Protein automated matches [226855] (1 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224977] (9 PDB entries) |
![]() | Domain d3jv4a_: 3jv4 A: [247053] Other proteins in same PDB: d3jv4b_, d3jv4d_, d3jv4f_ automated match to d1zk9a_ |
PDB Entry: 3jv4 (more details), 3.15 Å
SCOPe Domain Sequences for d3jv4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jv4a_ b.1.18.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tselricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsqadvhrqiai vfktppyedleisepvtvnvflqrltdgvcseplpftylpr
Timeline for d3jv4a_: