Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.3: Small subunit [58132] (3 proteins) |
Protein Eukaryotic, cytoplasmic (40S subunit) [254422] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [254865] (1 PDB entry) |
Domain d3izbk_: 3izb K: [247005] |
PDB Entry: 3izb (more details), 8.8 Å
SCOPe Domain Sequences for d3izbk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3izbk_ i.1.1.3 (K:) Eukaryotic, cytoplasmic (40S subunit) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} iyasfndtfvhvtdlsgketiarvtggmkvkadrdesspyaamlaaqdvaakckevgita vhvkiratggtrtktpgpggqaalralarsglrigriedvtpvpsdstrkkggrrgrrl
Timeline for d3izbk_: