![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.3: Small subunit [58132] (3 proteins) |
![]() | Protein Eukaryotic, cytoplasmic (40S subunit) [254422] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [254865] (1 PDB entry) |
![]() | Domain d3izbi_: 3izb I: [247003] |
PDB Entry: 3izb (more details), 8.8 Å
SCOPe Domain Sequences for d3izbi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3izbi_ i.1.1.3 (I:) Eukaryotic, cytoplasmic (40S subunit) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} avahvkagkglikvngspitlvepeilrfkvyeplllvgldkfsnidirvrvtggghvsq vyairqaiakglvayhqkyvdeqsknelkkaftsydrtlliadsrrpepkkfggkgarsr fqksyr
Timeline for d3izbi_: