Lineage for d3imlb3 (3iml B:236-387)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976427Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2976428Protein automated matches [254617] (15 species)
    not a true protein
  7. 2976429Species Burkholderia pseudomallei [TaxId:28450] [255893] (1 PDB entry)
  8. 2976435Domain d3imlb3: 3iml B:236-387 [246939]
    Other proteins in same PDB: d3imla4
    automated match to d2p02a3

Details for d3imlb3

PDB Entry: 3iml (more details), 2.35 Å

PDB Description: Crystal Structure Of S-Adenosylmethionine Synthetase From Burkholderia Pseudomallei
PDB Compounds: (B:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d3imlb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3imlb3 d.130.1.0 (B:236-387) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
iggpqgdcgltgrkiivdtyggaaphgggafsgkdpskvdrsaayagryvaknivaagla
sraliqvsyaigvaeptsvmvntfgtgrvsdetitklvrehfdlrpkgiiqmldllrpiy
ektaayghfgreepefsweaadkalalaeaag

SCOPe Domain Coordinates for d3imlb3:

Click to download the PDB-style file with coordinates for d3imlb3.
(The format of our PDB-style files is described here.)

Timeline for d3imlb3: