| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) ![]() |
| Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
| Protein automated matches [254617] (15 species) not a true protein |
| Species Burkholderia pseudomallei [TaxId:28450] [255893] (1 PDB entry) |
| Domain d3imlb1: 3iml B:5-99 [246937] Other proteins in same PDB: d3imla4 automated match to d2p02a1 |
PDB Entry: 3iml (more details), 2.35 Å
SCOPe Domain Sequences for d3imlb1:
Sequence, based on SEQRES records: (download)
>d3imlb1 d.130.1.0 (B:5-99) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
ylftsesvseghpdkvadqisdaildailaqdkysrvaaetlcntglvvlageitttani
dyiqiardtikrigydntdygidyrgcavlvaydk
>d3imlb1 d.130.1.0 (B:5-99) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
ylftsesvseghpdkvadqisdaildailaqdkysrvaaetlcntglvvlageitttani
dyiqiardtikrigycavlvaydk
Timeline for d3imlb1: