Lineage for d3imla1 (3iml A:1-102)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2976292Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 2976293Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 2976427Family d.130.1.0: automated matches [254267] (1 protein)
    not a true family
  6. 2976428Protein automated matches [254617] (15 species)
    not a true protein
  7. 2976429Species Burkholderia pseudomallei [TaxId:28450] [255893] (1 PDB entry)
  8. 2976430Domain d3imla1: 3iml A:1-102 [246934]
    Other proteins in same PDB: d3imla4
    automated match to d2p02a1

Details for d3imla1

PDB Entry: 3iml (more details), 2.35 Å

PDB Description: Crystal Structure Of S-Adenosylmethionine Synthetase From Burkholderia Pseudomallei
PDB Compounds: (A:) s-adenosylmethionine synthetase

SCOPe Domain Sequences for d3imla1:

Sequence, based on SEQRES records: (download)

>d3imla1 d.130.1.0 (A:1-102) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mandylftsesvseghpdkvadqisdaildailaqdkysrvaaetlcntglvvlageitt
tanidyiqiardtikrigydntdygidyrgcavlvaydkqsp

Sequence, based on observed residues (ATOM records): (download)

>d3imla1 d.130.1.0 (A:1-102) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mandylftsesvseghpdkvadqisdaildailaqdkysrvaaetlcntglvvlageitt
tanidyiqiardtikrigydgcavlvaydkqsp

SCOPe Domain Coordinates for d3imla1:

Click to download the PDB-style file with coordinates for d3imla1.
(The format of our PDB-style files is described here.)

Timeline for d3imla1: