![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.2: GAF domain-like [55781] (5 families) ![]() alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654 |
![]() | Family d.110.2.0: automated matches [191507] (1 protein) not a true family |
![]() | Protein automated matches [190838] (16 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [255839] (2 PDB entries) |
![]() | Domain d3ibra2: 3ibr A:118-309 [246896] Other proteins in same PDB: d3ibra1, d3ibrb1 automated match to d3nhqa2 complexed with bla; mutant |
PDB Entry: 3ibr (more details), 2.97 Å
SCOPe Domain Sequences for d3ibra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ibra2 d.110.2.0 (A:118-309) automated matches {Pseudomonas aeruginosa [TaxId: 287]} lsitsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaes rredlesylglrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsy svlrsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsq vcsaiverleqg
Timeline for d3ibra2: