Lineage for d3ibra2 (3ibr A:118-309)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970256Family d.110.2.0: automated matches [191507] (1 protein)
    not a true family
  6. 2970257Protein automated matches [190838] (19 species)
    not a true protein
  7. 2970278Species Pseudomonas aeruginosa [TaxId:287] [255839] (2 PDB entries)
  8. 2970283Domain d3ibra2: 3ibr A:118-309 [246896]
    Other proteins in same PDB: d3ibra1, d3ibrb1
    automated match to d3nhqa2
    complexed with bla; mutant

Details for d3ibra2

PDB Entry: 3ibr (more details), 2.97 Å

PDB Description: crystal structure of p. aeruginosa bacteriophytochrome photosensory core module mutant q188l in the mixed pr/pfr state
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d3ibra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ibra2 d.110.2.0 (A:118-309) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
lsitsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaes
rredlesylglrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsy
svlrsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsq
vcsaiverleqg

SCOPe Domain Coordinates for d3ibra2:

Click to download the PDB-style file with coordinates for d3ibra2.
(The format of our PDB-style files is described here.)

Timeline for d3ibra2: