SCOPe 2.08: Domain d1btod1: 1bto D:1-163,D:340-374

Lineage for d1btod1 (1bto D:1-163,D:340-374)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.35: GroES-like [50128] (2 superfamilies)
   contains barrel, partly opened; n*=4, S*=8; meander

4. Superfamily b.35.1: GroES-like [50129] (3 families)

5. Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
   C-terminal domain is alpha/beta (classical Rossmann-fold)

6. Protein Alcohol dehydrogenase [50137] (9 species)
   contains a Zn-finger subdomain, residues 94-117

7. Species Horse (Equus caballus) [TaxId:9796] [50138] (53 PDB entries)
   Uniprot P00327

8. Domain d1btod1: 1bto D:1-163,D:340-374 [24680]
   Other proteins in same PDB: d1btoa2, d1btob2, d1btoc2, d1btod2
   complexed with nad, ssb, zn

Details for d1btod1

PDB Entry: 1bto, 2 Å

PDB Description: horse liver alcohol dehydrogenase complexed to nadh and (1s,3r)3-butylthiolane 1-oxide

PDB Compounds: (D:) liver alcohol dehydrogenase

SCOPe Domain Sequences for d1btod1:

Sequence; same for both SEQRES and ATOM records:

>d1btod1 b.35.1.2 (D:1-163,D:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
stagkvikckaavlweekkpfsieevevappkahevrikmvatgicrsddhvvsgtlvtp
lpviagheaagivesigegvttvrpgdkviplftpqcgkcrvckhpegnfclkndlsmpr
gtmqdgtsrftcrgkpihhflgtstfsqytvvdeisvakidaaXfaldplithvlpfeki
negfdllrsgesirtiltf

Timeline for d1btod1:

• d1btod1 first appeared (with stable ids) in SCOP 1.55
  
• d1btod1 appears in SCOPe 2.07