| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins) N-terminal all-beta domain defines family |
| Protein Alcohol dehydrogenase [51737] (9 species) |
| Species Horse (Equus caballus) [TaxId:9796] [51738] (53 PDB entries) Uniprot P00327 |
| Domain d1btod2: 1bto D:164-339 [29696] Other proteins in same PDB: d1btoa1, d1btob1, d1btoc1, d1btod1 complexed with nad, ssb, zn |
PDB Entry: 1bto (more details), 2 Å
SCOPe Domain Sequences for d1btod2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1btod2 c.2.1.1 (D:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]}
splekvcligcgfstgygsavkvakvtqgstcavfglggvglsvimgckaagaariigvd
inkdkfakakevgatecvnpqdykkpiqevltemsnggvdfsfevigrldtmvtalsccq
eaygvsvivgvppdsqnlsmnpmlllsgrtwkgaifggfkskdsvpklvadfmakk
Timeline for d1btod2: