![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
![]() | Protein automated matches [190038] (42 species) not a true protein |
![]() | Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [232152] (2 PDB entries) |
![]() | Domain d3i3ga_: 3i3g A: [246709] automated match to d3fb3b_ |
PDB Entry: 3i3g (more details), 1.86 Å
SCOPe Domain Sequences for d3i3ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i3ga_ d.108.1.0 (A:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} vdlelrvleesdlsshlellghlteapplsgvelaniadmrrragivtkvfchqptgriv gsaslmiqpkftrggravghiedvvvdpsyrgaglgkalimdlceisrskgcykvildss ekslpfyeklgfraherqmrldl
Timeline for d3i3ga_: