Lineage for d3i3bd3 (3i3b D:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830645Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2830653Species Escherichia coli [TaxId:562] [51511] (46 PDB entries)
    Uniprot P00722
  8. 2830733Domain d3i3bd3: 3i3b D:334-625 [246666]
    Other proteins in same PDB: d3i3ba1, d3i3ba2, d3i3ba4, d3i3ba5, d3i3bb1, d3i3bb2, d3i3bb4, d3i3bb5, d3i3bc1, d3i3bc2, d3i3bc4, d3i3bc5, d3i3bd1, d3i3bd2, d3i3bd4, d3i3bd5
    automated match to d1jz7a5
    complexed with 149, dms, mg, na

Details for d3i3bd3

PDB Entry: 3i3b (more details), 2.2 Å

PDB Description: e.coli (lacz) beta-galactosidase (m542a) in complex with d- galactopyranosyl-1-on
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3i3bd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3bd3 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahaagnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3i3bd3:

Click to download the PDB-style file with coordinates for d3i3bd3.
(The format of our PDB-style files is described here.)

Timeline for d3i3bd3: