| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
| Protein beta-Galactosidase [49804] (3 species) |
| Species Escherichia coli [TaxId:562] [49805] (46 PDB entries) Uniprot P00722 |
| Domain d3i3ba1: 3i3b A:13-219 [246649] Other proteins in same PDB: d3i3ba2, d3i3ba3, d3i3ba4, d3i3ba5, d3i3bb2, d3i3bb3, d3i3bb4, d3i3bb5, d3i3bc2, d3i3bc3, d3i3bc4, d3i3bc5, d3i3bd2, d3i3bd3, d3i3bd4, d3i3bd5 automated match to d1f49a3 complexed with 149, dms, mg, na |
PDB Entry: 3i3b (more details), 2.2 Å
SCOPe Domain Sequences for d3i3ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i3ba1 b.18.1.5 (A:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3i3ba1:
View in 3DDomains from same chain: (mouse over for more information) d3i3ba2, d3i3ba3, d3i3ba4, d3i3ba5 |