Lineage for d3i3bd1 (3i3b D:13-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774233Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2774234Protein beta-Galactosidase [49804] (3 species)
  7. 2774242Species Escherichia coli [TaxId:562] [49805] (46 PDB entries)
    Uniprot P00722
  8. 2774322Domain d3i3bd1: 3i3b D:13-219 [246664]
    Other proteins in same PDB: d3i3ba2, d3i3ba3, d3i3ba4, d3i3ba5, d3i3bb2, d3i3bb3, d3i3bb4, d3i3bb5, d3i3bc2, d3i3bc3, d3i3bc4, d3i3bc5, d3i3bd2, d3i3bd3, d3i3bd4, d3i3bd5
    automated match to d1f49a3
    complexed with 149, dms, mg, na

Details for d3i3bd1

PDB Entry: 3i3b (more details), 2.2 Å

PDB Description: e.coli (lacz) beta-galactosidase (m542a) in complex with d- galactopyranosyl-1-on
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3i3bd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i3bd1 b.18.1.5 (D:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3i3bd1:

Click to download the PDB-style file with coordinates for d3i3bd1.
(The format of our PDB-style files is described here.)

Timeline for d3i3bd1: