Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
Protein automated matches [190447] (55 species) not a true protein |
Species Escherichia coli [TaxId:562] [225534] (4 PDB entries) |
Domain d3hycg_: 3hyc G: [246612] automated match to d2r8xh_ complexed with cl, mg |
PDB Entry: 3hyc (more details), 3.06 Å
SCOPe Domain Sequences for d3hycg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hycg_ c.108.1.0 (G:) automated matches {Escherichia coli [TaxId: 562]} latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs i
Timeline for d3hycg_: