PDB entry 3hyc

View 3hyc on RCSB PDB site
Description: Crystal structure of E. coli phosphatase YrbI, with Mg, tetragonal form
Class: hydrolase
Keywords: YrbI, KdsC, phosphatase, Hydrolase, Lipopolysaccharide biosynthesis, Magnesium
Deposited on 2009-06-22, released 2009-09-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.06 Å
R-factor: 0.242
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:37762]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hyca_
  • Chain 'B':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:37762]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hycb_
  • Chain 'C':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:37762]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hycc_
  • Chain 'D':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:37762]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hycd_
  • Chain 'E':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:37762]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hyce_
  • Chain 'F':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:37762]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hycf_
  • Chain 'G':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:37762]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hycg_
  • Chain 'H':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Escherichia coli [TaxId:37762]
    Gene: yrbI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3hych_
  • Heterogens: MG, CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3hycA (A:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hycA (A:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3hycB (B:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hycB (B:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkld
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3hycC (C:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hycC (C:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3hycD (D:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hycD (D:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldea
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3hycE (E:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hycE (E:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3hycF (F:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hycF (F:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3hycG (G:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hycG (G:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3hycH (H:)
    mskagaslatcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgy
    gircaltsdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenv
    ayvgddlidwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkl
    deakgqsi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3hycH (H:)
    latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
    sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
    idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
    i