Lineage for d3hycc_ (3hyc C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490779Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2490780Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2491513Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2491514Protein automated matches [190447] (53 species)
    not a true protein
  7. 2491667Species Escherichia coli [TaxId:562] [225534] (4 PDB entries)
  8. 2491705Domain d3hycc_: 3hyc C: [246608]
    automated match to d2r8xh_
    complexed with cl, mg

Details for d3hycc_

PDB Entry: 3hyc (more details), 3.06 Å

PDB Description: Crystal structure of E. coli phosphatase YrbI, with Mg, tetragonal form
PDB Compounds: (C:) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase

SCOPe Domain Sequences for d3hycc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hycc_ c.108.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
latcygpvsadvmakaenirllildvdgvlsdgliymgnngeelkafnvrdgygircalt
sdievaiitgrkaklvedrcatlgithlyqgqsnkliafsdlleklaiapenvayvgddl
idwpvmekvglsvavadahpllipradyvtriaggrgavrevcdllllaqgkldeakgqs
i

SCOPe Domain Coordinates for d3hycc_:

Click to download the PDB-style file with coordinates for d3hycc_.
(The format of our PDB-style files is described here.)

Timeline for d3hycc_: